BIG LIST OF WEBSITES

List of Top Websites Like Livingwaychristianfriendshipgroup.com

Top 250 Websites Like LIVINGWAYCHRISTIANFRIENDSHIPGROUP.COM

Download the Top 250 Websites to PDF

Last updated on Apr 1 2024.
Here are the best websites we found: liv.me • citi.com • dailylife.com.au • liv.me • ally.com • citibankonline.com • kalorydeficit.com • bajajallianzlife.com • lifecoach-directory.org.uk

Press CTRL-D to bookmark this list - BigListofWebsites.com
Rank
Url
Preview
Tags
Score
Liv. - Digital Lifestyle Banking. Liv. is the first lifestyle banking app that works around what you like and how you spend your time. Launched by Emirates NBD, Liv. boosts your lifestyle.. Lifestyle, Spending, Savings, Banking, Friends, Venues, Life, Live Life, Offers, Deals
Alexa Rank
341,926
Online Banking, Mortgages, Personal Loans, Investing | Citi.com. Open a bank account from Citi checking and savings accounts and CDs, to banking IRAs. Apply for a personal loan, or learn how to invest in your financial future.
Alexa Rank
418
Lifestyle | Daily Life | News | The Sydney Morning Herald. The latest Lifestyle | Daily Life news, tips, opinion and advice from The Sydney Morning Herald covering life and relationships, beauty, fashion, health & wellbeing
Alexa Rank
288,942
Liv. - Digital Lifestyle Banking. Liv. is the first lifestyle banking app that works around what you like and how you spend your time. Launched by Emirates NBD, Liv. boosts your lifestyle.
Alexa Rank
341,926
Banking, Investing, Home Loans & Auto Finance | Ally. Whether it's banking, investing, home loans or auto finance, nothing stops us from doing right by you. Ally. Do It Right.
Alexa Rank
1,817
Online Banking, Mortgages, Personal Loans, Investing | Citi.com. Open a bank account from Citi checking and savings accounts and CDs, to banking IRAs. Apply for a personal loan, or learn how to invest in your financial future.
Alexa Rank
1,595
HEALTHY LIFESTYLE - Life is not merely being alive, but being well.. Life is not merely being alive, but being well.
Alexa Rank
398,679
Life Insurance Plans - Buy Life Insurance Policies In India | Bajaj Allianz Life. Life insurance plans from Bajaj Allianz Life - get all types of life insurance plans - ULIP Plans, Term Insurance Plans, Pension Plans etc., at affordable premiums to get your Life Goals Done.
Alexa Rank
334,482
Life Coach Directory – Find a Life Coach or NLP Practitioner Near You. Life Coach Directory is a comprehensive database of UK life coaches and NLP practitioners with information on their training and experience, fees and contact details.
Alexa Rank
371,550
Lifestyle A2Z – Lifestyle A2Z. Lifestyle A2Z
Alexa Rank
73,892
Life Chats - Motivation For Real Life. Life Chats About Life Things-Blog- We write here about all of our subjects to include Motivational Mondays, Happiness, Real Life, Relationships, Family, and more...
Alexa Rank
89,332
Life in a House – laugh. live. love. repeat.. Life in a House covers everything for families from food, finances, health, travel, parenting, grandparenting and more to keep you on your game each day.
Alexa Rank
93,636
Banking News Bangladesh | A Platform for Bankers Community. Bank News Bangladesh- A Platform for Bankers Community. Banking News for Bangladeshi Bankers and Customers. Banking Information for Bankers and Customers.
Alexa Rank
158,769
LIFE WITH SONIA | LIFE IS A GIFT NOT A GUARANTEE. Life is a Gift, Not a Guarantee. Life is a journey and I want to share Living life, learn and grow as a single mum. I will share some advice and lots of fun and laughter.
Alexa Rank
190,332
Life Insurance leads | Insurance Selling Ideas | Recruiters Ideas. Life insurance leads | Prospecting | Recruiting agents | Selling life insurance | Success formulas | See over 200 proven and tested ideas on our website
Alexa Rank
259,538
Life is Messy and Brilliant | Art, Inspiration, & Printables. Life is Messy and Brilliant is a creative blog about bullet journaling, digital planning, free printables, and college tips.
Alexa Rank
547,894
lifestyle.com - This website is for sale! - Shopping Resources and Information.. This website is for sale! lifestyle.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, lifestyle.com has it all. We hope you find what you are searching for!
Alexa Rank
190,325
Life in Belgrade | Life in Belgrade portal. Life in Belgrade portal - vesti, adresar, rubrike: Business Way, Culture&Art, Fashion World, Horeca, Tourist Info, Total Beauty, Lifestyle, Techworld, Speed, Sporting Life, Health, Education.
Alexa Rank
245,800
Banking Services: Checking, Savings, Mortgage | Regions. Regions offers a full spectrum of banking services. Visit us online or at one of our many bank branch locations for checking, savings, mortgages and more.
Alexa Rank
6,608
LIFE TRNDS: Let your adventure begin.. Life TRNDS provides travel and lifestyle benefits to members at amazing prices.
Alexa Rank
159,547
Lifestyle Wizard - Lifestyle Wizard. Lifestyle Wizard
Alexa Rank
190,329
Life, Hope & Truth. Life, Hope and Truth: providing insights and understanding about the purpose of life and real hope for a better future based on the truth of the Bible.
Alexa Rank
190,302
Life Beyond Sport | Passion For Luxury & Lifestyle. Life Beyond Sport is a publication what has an editorial mix that switches between lifestyle interviews with sportsmen and other luxury lifestyle subjects.
Alexa Rank
225,987
Life Space. Life Space is a Social Networking Platform. With our new feature, user can posts, photos, video
Alexa Rank
210,551
Life Insurance Policies - Life Insurance Plans. Life Insurance- Aviva is one of the leading life insurance companies in India that offers range of Life Insurance Policy, saving plan, retirement plans with maximum coverage for individual and family. Use our Life Insurance Calculator to calculate premium online.
Alexa Rank
250,081
Banking and Finance | Software Solutions for Banks & Financial Services. Enabling Digital Transformation for Banking & Financial Services with a blend of Software Solutions and Deep Domain expertise. Nelito offers core banking software and solutions.
Alexa Rank
300,484
Life Science Recruitment | Hyper Recruitment Solutions. HRS is a scientific recruitment company specialising in life sciences. Browse UK life science jobs and apply online with Hyper Recruitment Solutions.
Alexa Rank
294,764
Life Skills Education|21st Century Skills - Skillizen. Is your child ready to lead in 21st century skills? Life Skills education that enables them to achieve the most in the smartest possible way.
Alexa Rank
305,817
Life Patch İnternational. Life Patch İnternational
Alexa Rank
312,224
Lifestyle Blog for 20 Somethings | LeisureMartini. LeisureMartini is a lifestyle blog for 20 somethings that offers articles and tips for men and women fashion, travel, bollywood and hollywood movies, politics.
Alexa Rank
406,308
life is beautiful. life is beautiful -
Alexa Rank
520,783
Life Made Sweeter - Healthy & Delicious Recipes to sweeten up your life. Healthy & Delicious Recipes to sweeten up your life
Alexa Rank
85,204
Life Insurance That''s Actually Simple | Haven Life. Haven Life offers an easy way to buy high-quality, affordable term life insurance online. Get your real rate today.
Alexa Rank
93,247
Life Insurance [#1 in Canada] | No Medical Exam | Emma. Get the fastest life insurance in Canada. Prices start at $8/month. No medical exam. It's simple, safe and affordable with Emma. Protect your loved ones now.
Alexa Rank
100,775
Life Coach Code - Reprogram To Superhuman. We are focused on improving The Spirit, The Mind, The Body, and The Heart! Life Coach Code aims to reprogram the readers into their full potential...
Alexa Rank
128,396
Life in a Break Down | UK Lifestyle Blog. An eclectic UK lifestyle blog full of opinions, reviews and the occasional cute pet photo.
Alexa Rank
214,904
Life Insurance - Get A Free Online Quote Today | JennyLifejennylife.com. Jenny Life offers more than just affordable life insurance - we help busy families thrive. No Exams. No Waiting. Get Your Instant Life Insurance Quote Today!
Alexa Rank
319,254
. . . Life. - A lifestyle blog celebrating the little things that make life great.. A lifestyle blog celebrating the little things that make life great.
Alexa Rank
438,611
Life Dehydrated ⋆ When Dehydrating is LIFE! Your one stop for dehydrating advice & help =). When Dehydrating is LIFE! Your one stop for dehydrating advice & help =)
Alexa Rank
413,584
LIFE EXPLORER. Dear Visitors, welcome to my personal blog page. :-) I name this blog Life Explorer or LE, because the initial idea of creating this blog was that I would like to write and share about what I experienced in my life, that I think it might also be useful for other people too. Please correct me if…
Alexa Rank
422,537
Friends of the Earth Europe |. We campaign for sustainable and just societies and for the protection of the environment. We unite more than 30 national groups with thousands of local groups and are part of the world's largest grassroots environmental network, Friends of the Earth International.
Alexa Rank
477,461
Life Time Healthy Way of Life | Join Life Time. With top classes, expert instructors and luxurious spaces, Life Time is more than a gym — it’s a luxury athletic resort.
Alexa Rank
50,164
Life.hu az élet női oldala. Life a női portál. Pikáns, provokatív, szexi, nőies, csajos, friss és érdekes.
Alexa Rank
19,754
Life Extension Europe | Science-based supplements, vitamins, minerals, omegas etc | Improve your health today. Life Extension Europe - nutritional supplements, vitamins, minerals, antioxidants, omegas, fish oil, amino acids, herbs, probiotics and more. 500+ supplements with strong science behind and focus on quality, purity & potency.
Alexa Rank
190,299
::Life Foundation NGO, Hojai, Assam:: Ngo in Assam | Ngo in India | healthcare ngo india| Non Profit Organisation | Education For Poor Children | Donate Online For Underprivileged Children | Poor children | Donate for education | sponsor a child | education for underprivileged children | education | Life Foundation. Life Foundation is an NGO in Hojai, Assam, India. Our main aim is basically emerged to address the issue of Child trafficking, Child Education, Health, Women Empowerment, Youth affairs education for underprivileged children, girl child, and give support for poor children''s health. Donate for education to support poor children.
Alexa Rank
297,807
Life Interiors - Home. Shop stylish and affordable furniture and homewares for your lounge, dining room and bedroom online or visit our Sydney & Melbourne Showrooms! We ship Australia wide.
Alexa Rank
236,791
LifeStyle | Sống Phong Cách. LifeStyle - Sống Phong Cách
Alexa Rank
355,056
Online Banking, Mortgages, Personal Loans, Investing | Citi.com. Open a bank account from Citi checking and savings accounts and CDs, to banking IRAs. Apply for a personal loan, or learn how to invest in your financial future.
Alexa Rank
6,127
Life Insurance | Supplemental Health Insurance | American Income Life. American Income Life provides affordable life insurance and supplemental health benefits to working families in the United States, Canada, and New Zealand. Learn More.
Alexa Rank
49,721
Life Insurance | Term Insurance | Life Insurance Policies - Reliance Nippon Life Insurance. Reliance Nippon Life Insurance offers life insurance policies in India with a claim settlement ratio of 98.1%. Buy a life insurance policy now.
Alexa Rank
62,412
Hypto – Best Payouts, Fund Transfer and Banking APIs in India. Banking and fund transfer platform in India | Hypto provides the best fund transfer and payment APIs in India with highest success rate at cheapest cost and instant onboarding.
Alexa Rank
82,871
Banking, Mortgages, Auto Loans, Investing. We offer a full range of banking services, retail, commercial, lending, investment, treasury management, private banking. We're happy you're here.
Alexa Rank
96,305
Life Coach, Business Coach, Career Coach, Executive Coach Directory | Noomii. Find a life coach or business coach near you on the web''s largest network of independent coaches. Reviews, free consults and personalized matching.
Alexa Rank
127,153
Lifestyle | Fashion | Health| Fitness | Travel | Holiday| Entertainment. Lifeandtrendz.com A Complete Portal on Lifestyle , Beauty , Health , Fashion , and Entertainment.
Alexa Rank
154,170
Life Insurance Policies | Term Life Insurance | Life Insurance Quote. Quotacy helps you choose the right life insurance policies. We check other top-rated life insurance companies to make sure you get the best price.
Alexa Rank
169,940
Life Insurance. AIG Life insurance helps keep life going and protecting your loved ones’ financial future. There are a variety of options available to meet your needs that can help pay off debts, cover college costs or even pay the mortgage while you are living. Get a quote today.
Alexa Rank
178,087
Banking Software Solutions | FPS GOLD. Helping financial institutions compete, profit, and thrive by providing state-of-the-art banking software and superior customer service since 1964.
Alexa Rank
185,794
Life After Hysterectomy Surgery - What Is It Really Like?. This is an exclusive resource for women to improve their overall health and quality of life after hysterectomy surgery. Side effects you may experience due
Alexa Rank
240,710
Life Insurance For Canadians | LIFC.ca. At LIFC you have found one place to get information on life insurance, obtain rates from leading Canadian providers as well as a place to buy your plan with assistance of our experienced advisors.
Alexa Rank
242,502
Life, Medicare, Home, Auto, Business Insurance in Westminster Colorado - 3T Insurance, LLC. Independent insurance agency in Westminster Colorado offering life, medicare, home, auto and business insurance
Alexa Rank
252,654
Best Life Insurance Policy & Plans in India | Exide Life Insurance. Life insurance plans by Exide Life Insurance. Choose the best life insurance policy, ULIPs, child plans and pension plans online. Get Quote Now
Alexa Rank
291,346
#1 The Best Banking Software - eWallet Script - Banking Software Script - Ewallet Software. Banking Software, The Best Banking Software, Banking Software, Online Banking Software, Core Banking Software, Online Banking Software, Banking Software Prices, Script Banking - Secure Paymentz
Alexa Rank
359,521
Life Insurance | HNB Assurance PLC. HNB Assurance is a leading & trusted Life Insurance company in Sri Lanka. We offer a range of the best insurance solutions covering health insurance, protection, savings, education and retirement needs.
Alexa Rank
365,558
life coach training | Fowler Intenational Academy | life coach classes. Fowler International Academy of Professional Coaching provides online training and certification in life coaching, personal coaching, career coaching, executive coaching, and business coaching since 2008.
Alexa Rank
460,791
Life Insurance Policy | SBI Life Insurance Plans in India. SBI Life, a leading life insurance company in India, offers a range of life insurance plans and policies to help you protect you and your family. Buy life insurance online, term insurance, ULIPs etc. at affordable premium. Get instant quotes.
Alexa Rank
17,059
Capital Express Assurance Limited | Life Insurance in Nigeria. Capital Express Assurance is reckoned to be one of the fastest growing Life Insurance companies in Nigeria. With a formidable reinsurance treaty.
Alexa Rank
109,678
Life, Earth & Health Sciences Article Supply Services. We supply science PDF full texts scanned at libraries. Providing 54+ million PubMed and Natural Sciences articles.
Alexa Rank
476,938
Banking Services & Financial Planning | POSB Singapore. POSB Singapore offers personal banking products like savings accounts, investments, insurance, personal loans, and online banking services. Visit our site to apply for a product or to learn more about financial planning.
Alexa Rank
29,346
Life in Kraków – Życie w mieście, miasto w życiu.. Serwis dla wszystkich, którzy są ciekawi niecodziennych miejsc, zdarzeń i ludzi. Kraków, lifestyle,hobby,relaks,rozrywka,kultura,imprezy,zakupy,opinie.
Alexa Rank
51,751
Life Insurance | Financial Services | Retirement Planning | National Life Group. National Life Group offers life insurance, annuity and investment products to help individuals, families and businesses pursue their financial goals.
Alexa Rank
54,451
Lifestyle for women - Fashionlib. Lifestyle for women
Alexa Rank
61,789
Life Management For You where the Journey Begins With You. The Journey begins with you when you start making changes to a better life. Be it physically, mentally, emotionally or spiritually. Reconnect with your spirit
Alexa Rank
98,360
Life Is An Adventure-The Disney Gals. Life Is An Adventure shares simple ideas for travel, family, food, and fun and how to spend less time planning and more time living because life is an adventure waiting to happen.
Alexa Rank
107,563
AARP Life Insurance from New York Life: Official Website. Life insurance coverage up to $100,000 for AARP members from New York Life. Term, permanent and more.
Alexa Rank
108,020
Lifestyle Lounge | Washington swingers social community for adults and singles. Created by real swingers. Lifestyle Lounge is a social community for the all swingers. The site is full of swinger profiles, parties, events, travel and more
Alexa Rank
113,388
Life Ant - Carrying You Along The Way. Life Ant will compare life insurance quotes to help you save money. Comparing prices for whole life, term life, or Universal life from all major providers is fast, free, and easy.
Alexa Rank
190,295
Life Lessons Club - Life Lessons. Life Lessons
Alexa Rank
190,305
Life Bible-Presbyterian Church. Life Bible-Presbyterian Church
Alexa Rank
220,366
Life Coach Training Courses Online Australia | Executive Coaching. Life coach training courses online australia : You want to go to the best executive coaching Certification program available,so start today.
Alexa Rank
278,301
life.pk coming soon!!!
Alexa Rank
334,929
Lifestyle & Parenting Blog - Life With Munchers | Modern Family Living. Lifestyle & parenting blog dedicated to modern living. Documenting family life through home makeovers, organising, parenting and more.
Alexa Rank
391,741
Life Dating Love - Life, dating, and love— like it should be (the way you want it).. Life, dating, and love— like it should be (the way you want it).
Alexa Rank
356,773
Life Insurance Quotes | AIG Direct. Get competitive life insurance quotes from AIG Direct! We offer affordable rates on top rated life insurance coverage, get your life insurance quote today!
Alexa Rank
402,661
Lifestyle.mn – Таны туслах
Alexa Rank
497,613
LIFe - Lanka Interoperability Framework
Alexa Rank
454,399
wikiHow Life - Trustworthy How To Instructions. Learn how to have better relationships and care for youself with wikiHow.life. Easy, step-by-step, illustrated instructions to help you live your best life.
Alexa Rank
530,306
giftlab - Life's a party. Gift responsibly.. Life's a party. Gift responsibly.
Alexa Rank
38,870
Consumer Banking | Personal Banking | U.S. Bank. Bank smarter with U.S. Bank and browse personal and consumer banking services including checking and savings accounts, mortgages, home equity loans, and more.
Alexa Rank
40,815
USA.Life Social Network. USA.Life social network is the answer to Facebook and Twitter censoring Christians, conservatives and liberty. USA.Life is the Christian Facebook alternative and the conservative Facebook alternative. www.USA.Life gives you freedom, privacy and real news. Join now!
Alexa Rank
17,910
Expert Banking Consultants - Cornerstone Advisors. Banking consultants aiding in strategic planning, contract negotiations, performance improvement, mergers, vendor management, and system selection.
Alexa Rank
182,777
Female Foodie | Life's too short to eat bad food. Life's too short to eat bad food
Alexa Rank
185,255
Alternative Therapies | Motivational Magazines | Life Positive. Get healing through Alternative Therapies from renowned therapists across the country at Life Positive.
Alexa Rank
297,814
BMO Harris - Personal Banking, Business Banking, Loans & Investing. Bank with BMO Harris, we are here to help. Explore our banking, mortgage and investment products. Enroll today for online banking with BMO Harris Bank.
Alexa Rank
31,054
Edelweiss Tokio Life Insurance - Insurance Plans and Policies in India. Buy Edelweiss Tokio Life Insurance online and avail long term financial protection and life cover with monthly premium as low as 1000 INR. Explore from the wide range of best life insurance policy products like term plans, savings and investment plans, ULIP, group and microinsurance.
Alexa Rank
55,225
The Life Coach School. The Life Coach School has the latest, laser-like tools and cutting-edge training to manage thoughts, emotions, actions and therefore results.
Alexa Rank
61,456
Fabulous Life. Fabulous Life - A blog giving information about PLACES, WONDERFUL THINGS, WONDERFUL DESTINATIONS IN THE WORLD, HEALTH TIPS, BEAUTY TIPS etc. which can make your life more BEAUTIFUL, AMAZING and FABULOUS to live it fullest.
Alexa Rank
291,457
My life | Friends, Family, and Zamazingos :-)  - Blog
Alexa Rank
478,596
Lifestyle is what you do, it is who you are! – Live, smile, be happy. Live, smile, be happy
Alexa Rank
132,184
Lifestyle of a Singaporean Blogger - I am the narrator. These are my chapters of arts, beauty, food and inspirations.. I am the narrator. These are my chapters of arts, beauty, food and inspirations.
Alexa Rank
164,540
Lifestyle and Health | Make Yourself a Better Person | William
Alexa Rank
297,817